Skip to main content

Table 3 Detail of the predicted sequences from the studied antimicrobial proteins.

From: A theoretical approach to spot active regions in antimicrobial proteins

Proteins Identified sequences Experimental data reported
hCAP 18 RKSKEKIGKEFKRIVQRIKD LLGDFFRKSKEKIGKEFKRIVQRIKD FLRNLVPRTES [17]
CAP 11 LGGRRFRRMVGLRKKFRKTRKRIQKLGRKIGKTGRKVWKAW GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAW REYGQIPYPCRI [19]
CRAMP RFKKKISLRAGLLRKGG.... EKLKKIGQKIKNFFQ
SVRFRVKETV
ISLRAGLLRKGG EKIGEKLKKIGQKIKNFFQ KLVPQPE [21]
BPI SVHVHISKSKVGWLIQLFHK
NCIKISGKWKAQKRFLK
KSKVGWLIQLFHK K [23]
ISNANIKISGKWKAQKRFLK MSGNFDLSI*
Histone H2A GRGKQGGKVRAKAKTRS//GRVHRLLRKG
KKTRIIPRHLQL
SGRGKQGGKVRAKAKSRSSR AGLQFPVGRVHRLLRKG NY [25]
Lysozyme AKSRWYNQTPNRAKRVITTFRT WDEAAVNLAKSRWYN[27]
Azurocidin SGGRLSRFPRFVNV
PNNVCTGVLTRRGGI
50% sequence identity with protegrin antimicrobial peptides
α-defensin YGTCIYQGRLWAFCC RYGTCIYQGRLWAFS[36]
β-defensin TLQKYYCRVRGGRCAVLSC
KCSTRGRKCCRRKK
GIINTLQKYYSRVRGGR
KSSTRGRKSSRRKK[37]
θ-defensin GLRCICTRGFCRLL RCICTRGFCRLL[39]
Magainin precursor IGKFLHSAKKFGK GIGKFLHSAKKFGK AFVGEIMNS [40]
Moronecidin HIFRGIVHVGKTIHRLVT FFHHIFRGIVHVGKTIHKLVT G [44]
Pleurocidin FFKKAAHVGKHVG GWGSFFKKAAHVGKHVG KAALTHYL [45]
Bacteriocin enterocin SCNKKGSCPGVKYGKKLGG KYYGNGVSCNKKGCSV[49]
Helveticin J VVQKGNVGSKYVYGLQLRKGA No active peptide reported
Sarcotoxin IA WLKKIGKKIERVGQ W35 is described as a key residue in endotoxin neutralizing activity [52]
RNase 3 INNYRWRCKNQNTFLR
VNVCGNQSIRCPHNRTLNNCHRSRFRVPL
TIAMRAINNYRWRSKNQNTFLR[61]
RNase 7 NINKHTKRCK
SHGRVSLTMCKLTSGKYPNCRYKEKRQNKSYVVA
No active peptide reported
SPAG 11K QLLRHPVKRAPIIRRIP N -terminus suggested [68]
Hepcidin LCRFCCKCCRNKGCGYCCKF No active peptide reported
Ace AMP1 ICPRVNRIVT
VNTRNLRRAACRCLVGVVNRNPGLRRNPR
RNTFVRPFWWRPRIQCGRI
No active peptide reported
  1. * United States Patent n° 5830860
  2. The first column includes the identified sequences by the prediction approach. The corresponding active peptides previously described in the literature and tested experimentally are included in the adjacent column for comparison. Matching residues between the identified and experimentally active sequences are underlined and highlighted in bold.