Skip to main content

Table 7 A fragment of the text output of this heterogeneous pipeline workflow (see Figure 14)

From: Applications of the pipeline environment for visual informatics and genomics computations

                   FASTAReadsMappingtoReferenceGenome_2.OutputUnmapped-1.map
>HBA_HUMAN P69905 Hemoglobin subunit alpha (Hemoglobin alpha chain) (Alpha-globin)
LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQV
>GHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPA
EFTPAVHASLDKFLASVSTVLTSKY
>HBB_HUMAN P68871 Hemoglobin subunit beta (Hemoglobin beta chain) (Beta-globin) (LVV-hemorphin-7)
LTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKV
>AHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGK
EFTPPVQAAYQKVVAGVANALAHKY