Skip to main content

Table 1 Clinod output formats

From: NoD: a Nucleolar localization sequence detector for eukaryotic and viral proteins

Format name Format Description Example outputa
MINIMAL Sequence name and number of NOLS predicted > NOL12
NOLS_segment_number: 2
SHORT Same as MINIMAL plus, start and end position of each NOLS > NOL12
NOLS_segment_number: 2
NOLS_segments_positions: 1-20, 165-213
MEDIUM (default) Same as SHORT plus the sequences of all NOLS > NOL12
NOLS_segment_number: 2
NOLS_segments_positions: 1-20, 165-213
NOLS_segments: MGRNKKKKRDGDDRRPRLVL, TASLHAHSRKKVKRRLTGKARHSGE
FULL Same as MEDIUM plus the predictor score for each residue in the sequence > NOL12
NOLS_segment_number: 2
NOLS_segments_positions: 1-20, 165-213
NOLS_segments: MGRNKKKKRDGDDRRPRLVL, TASLHAHSRKKVKRRLTGKARHSGE
0.87
0.79
0.69
...
COMPLETE Same as FULL plus the input sequences > NOL12
MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALE...
NOLS_segment_number: 2
NOLS_segments_positions: 1-20, 165-213
NOLS_segments: MGRNKKKKRDGDDRRPRLVL, TASLHAHSRKKVKRRLTGKARHSGE
0.87
0.79
0.69
...
  1. a The sequences and scores are truncated in the Table for clarity of presentation.