Skip to main content

Table 4 8 cancer-specific peptide markers identified in breast cancer

From: SASD: the S ynthetic A lternative S plicing D atabase for identifying novel isoform from proteomics

Peptide sequence gene transcript mode type pvalue h c
SWGGRPQRMGAVPGGVWSAVLMGGAR ERBB2 ENST00000269571 i18 INTRON_AS 9.48E-05 4 20
QTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLI(G)LLHSSVK BRCA2 ENST00000380152 E7_E11 E_E_AS 8.57E-04 1 12
SLWLQSQPHFCCFWLTVTFPPPLQ^THRELAQSSHAQR NTRK3 ENST00000317501 i2_E3 i_E_AS 1.22E-02 2 10
WGLLLALLPPGAASTQ(A)VWTWMTR ERBB2 ENST00000269571 E1_E16 E_E_AS 1.22E-02 2 10
LSWNHVARALTLTQSLVSSVTSGK NTRK3 ENST00000559764 i2 INTRON_AS 1.39E-02 4 13
CQ(G)EPYHDIRFNLMAVVPDR BAP1 ENST00000460680 E3_E9 E_E_AS 3.33E-02 9 18
QVLP^VGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPK PBRM1 ENST00000296302 E9_E29 E_E_AS 3.89E-02 6 14
DHLACW^DYDLCITCYNTKNHDHK EP300 ENST00000263253 E22_E31 E_E_AS 4.50E-02 4 11