Figure 6From: XLPM: efficient algorithm for the analysis of protein-protein contacts using chemical cross-linking mass spectrometryA representative MS/MS spectra derived from DSS-cross-linked peptide annotated by XLPM. The header in the graph depicts the scan number in the spectra. Fragment sequence 1: KGALVYVEADAANYVFERDDGSKGTTLSLVQK. Fragment sequence 2: YLKYSIASQPRR. Mass to charge: 1013.544006. Charge: 5+.Back to article page