Skip to main content

Table 1 StavroX results for DSS cross-linking of Rim1 tetramer

From: XLPM: efficient algorithm for the analysis of protein-protein contacts using chemical cross-linking mass spectrometry

Score m/z Charge Precursor mass Calculated mass PPM Sequence 1 Sequence 2 Cross-linked residues
233 542.5646 4 2167.237 2167.233 1.48 [DINLLKNGK] [DIDLLKNGK] 101-101
228 867.1219 3 2599.351 2599.34 4.25 [DGKK] [KGALVYVEADAANYVFER] 104-64
228 599.3096 3 1795.914 1795.915 -0.16 {mDFSK] [DINLLKDGK] 1-101
222 620.3467 4 2478.365 2478.36 1.97 [DINLLKNGK] [YLKYSIASEPR] 101-29
218 542.5644 4 2167.236 2167.233 1.26 [DINLLKNGK] [DIDLLKNGK] 101-101
190 533.9707 3 1599.898 1599.895 1.47 [NGKK] [DIDLLKDGK] 104-101
182 971.1868 3 2911.546 2911.541 1.59 [YLKYSIASQPR] [DDGSKGTTLSLVQK] 29-86
159 759.7696 5 3794.819 3794.812 1.96 [DINLLKNGK] [KLEDAEGQEDAASSELEHHHHHH} 101-105
149 1012.199 3 3034.581 3034.579 0.62 [DDGSKGTTLSLVQK] [DDGSKGTTLSLVQK] 86-86
134 1199.317 4 4794.246 4794.257 -2.19 [KGALVYVEADAANYVFER] [KLEDAEGQENAASSELEHHHHHH} 64-105
132 699.6585 4 2795.612 2795.613 -0.23 [DINLLKNGK] [GTTLSLVEKDINLLK] 101-95
129 900.9684 4 3600.852 3600.843 2.37 [DDGSKGTTLSLVQK] [KGALVYVEADAANYVFER] 86-64
125 702.6923 3 2106.062 2106.058 2.2 {mDFSK] [YLKYSIASQPR] 1 29
119 856.3835 4 3422.512 3422.509 0.96 {mDFSK] [KLEDAEGQENAASSELEHHHHHH} 1-105
118 636.6761 3 1908.014 1908.015 -0.51 {MDFSK] [DINLLKDGKK] 1-104
117 818.7658 6 4907.559 4907.547 2.43 [YLKYSIASQPR] [KGALVYVEADAANYVFERDDGSKGTTLSLVQK] 29-64
115 808.4442 3 2423.318 2423.31 3.26 {mDFSK] [GTTLSLVQKDINLLK] 1 95
115 792.6701 4 3167.659 3167.662 -1.17 [DIDLLKNGK] [KGALVYVEADAANYVFER] 101-64
112 646.1035 5 3226.489 3226.49 -0.37 [DGKK] [KLEDAEGQENAASSELEHHHHHH} 104-105
108 432.7513 4 1727.983 1727.99 -3.91 [DGKK] [DIDLLKNGKK] 104-104
108 982.3183 5 4907.562 4907.547 3.09 [DIDLLKNGKK] [MSIVGRIGSEFTEHTSANNNRYLKYSIASQPR] 104-29
  1. The table shows only the highest scoring results for a cross-linked pair