Skip to main content

Table 2 A: Information stored in PDBChainSaw for the G chain of bovine mitochondrial F1-ATPase (1OHHG) as an exemplar. In the field "chainid", the PDB four-letter code is followed by the single character chain identifier. The field "chainid2" is the concatenation of the PDB code and the ASCII value of the chain identifier, in this case, "71" corresponding to "G". B: The two other options to return the sequence from a protein structure stored in PDB file format.

From: MolTalk – a programming library for protein structures and structure analysis

A  
Fields Content
pdb 1OHH
code G
chainid 1OHHG
chainid2 1OHH71
residues 94
aminoacids 94
heterogens 0
solvent 0
sequence from co-ordinates (inferred) ATLKDITRRLKSIKNIQKITKSMKMVAAAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLCGAIHSSVAKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL
organism BOS TAURUS
compound ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL SYNONYM: BOVINE MITOCHONDRIAL F1-ATPASE GAMMA SUBUNIT
eccode 3.6.1.34
B  
sequence from co-ordinates without 'X' ATLKDITRRLKSIKNIQKITKSMKMVAAAKLCGAIHSSVAKQTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL
sequence from SEQRES ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVGSLALYEKADIKTPEDKKKHLIIGVSSDRGLCGAIHSSVAKQMKSEAANLAAAGKEVKIIGVGDKIRSILHRTHSDQFLVTFKEVGRRPPTFGDASVIALELLNSGYEFDEGSIIFNRFRSVISYKTEEKPIFSLDTISSAESMSIYDDIDADVLRNYQEYSLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL
\