Skip to main content

Table 1 Residue chains of the twenty one peptides used for the free energy comparison [22]

From: Development of a group contribution method for estimating free energy of peptides in a dodecane-water system via molecular dynamic simulations

Peptide number Residue Chain
1 PVVAPAPAPAPEVQTKH
2 QRAALIDCLAPDRRV
3 YQWTNNIGDAHTIG
4 PKDNTWYTGAKLG
5 GKNHDTGVSPVFA
6 MLSLGVSYRFGQG
7 THENQLGAGAFG
8 GAGAFGGYQVNP
9 TRPDNGMLSLGV
10 ALIDCLAPDRR
11 IATRLEYQWTN
12 TGNTCDNVKQR
13 KLGWSQYHDT
14 SVVVLGYTDR
15 QRAALIDCLA
16 DPKDGSVVVL
17 NNNGPTHENQLGAGAFGGYQV
18 IYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGV
19 WRADTKSNVYGKNHDTGVSPVFAGGV
20 AHTIGTRPDNGMLSLGVSY
21 VVVLGYTDRIGSDAYNQGLSERRAQSVVDYLI