Skip to main content

Table 1 Example of information extracted from the GenBank file and stored in geminivirus.org

From: Geminivirus data warehouse: a database enriched with machine learning approaches

TAGs Value
LOCUS KJ939916
DEFINITION Soybean chlorotic spot virus isolate BR:Flt14:11 segment DNA-A, complete sequence.
ORGANISM Soybean chlorotic spot virus
PUBMED 25028472
AUTHORS Sobrinho,R.R., Xavier,C.A.D., Pereira,H.M.B., Lima,G.S.A.,,Assuncao,I.P., Mizubuti,E.S.G., Duffy,S. and Zerbini,F.M.
.,JOURNAL Submitted Departamento de Fitopatologia, BIOAGRO, Universidade Federal de Vicosa, Av. Peter Henry Rolfs s/n, Vicosa, Minas Gerais 36570–900, Brazil
Assembly Method CodonCode Aligner v. 4.1.1 DEMO
Sequencing Technology Sanger dideoxy sequencing
host Macroptilium lathyroides
taxon 1221206
country Brazil
segment DNA-A
lat_lon  
collection_date 18-Mar-2012
collected_by  
CDS 199..954
gene  
note coat protein
product CP
protein_id AIN36521.1
translation MVKRDAPWRHMAGTSKVSRSSNFSPRGGGGPKNNRTSEWVNRPM …
ORIGIN ACCGGATGGCCGCGCGATTTTTTATGGGCCTTATCTTTTGGCTCGTTCTTTTGGACCGAGTGTATTTGAATTAAAGTAAAGTTATTCCCTGTCCAA................