Skip to main content

Table 2 188-D feature of cecropin A

From: An advanced approach to identify antimicrobial peptides and their function types for penaeus through machine learning strategies

Sequence KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
Property Value of feature vector
Amino acid composition 13.5 0.0 2.70 2.70 2.70 10.8 0.0
  135 00 27.0 27.0 27.0 108 00
  13.5 18.9 2.70 0.00 2.70 2.70 8.10
  135 189 27.0 0.00 27.0 27.0 81.0
  2.70 0.00 2.70 10.8 2.70 0.00  
  27.0 00 27.0 108 27.0 00  
Hydro-phobic 37.8 29.7 32.4 19.4 30.5 19.4 2.70
  378 297 324 444 555 444 27
  16.2 35.1 45.9 100. 32.4 48.6 64.8
  162 351 459 000 324 486 648
  81.0 97.2 5.40 13.5 40.5 70.2 94.5
  810 972 54 135 405 702 945