Skip to main content

Table 1 Predicted antigenic sites and their lengths using Bepipred [29] and IEDB [28] analysis tools

From: A highly conserved WDYPKCDRA epitope in the RNA directed RNA polymerase of human coronaviruses can be used as epitope-based universal vaccine design

Bepipred analysis IEDB analysis
Peptide Length (aa) Peptide Length (aa)
VRPGNFNQ 8 DYKVQLFEKYFKY 13
GNAAIT 6 HANCVNCTDDRCVLHCANFNVLFAM 25
DKSAGHPFN 9 KTCFGPIVRKIFVDGVPFVVSCGYHYKELGLV 32
SYQEQ 5 VSLHRHRLSLK 11
DVDNP 5 ADPAMHI 7
YPKCDRA 7 SSNAFLDLRTSCFSVAALTTG 21
YYVKPGGTSSGDATTAY 17 YDFVVSKG 8
   SVTLKHFFFA 10
   DYNYYSYN 8
   PTMCDIKQMLFCMEVVNKYFEI 22
   DGGCLNASEVVVNN 14
   KARVYYESM 9
   LKYAIS 6
   TVAGVSILS 9
   GATCVIGTT 9
   LKTLYKDV 8
   YPKCDRA 7
   CRIFASLILARKHGTCCTT 19
   YRLANECAQVLSEYVLCGGGYYVKPG 26
   ANSVFNILQA 10
   TANVSAL 7