Skip to main content

Table 4 Predicted conservancy of the antigenic site by using IEDB conservancy analysis [31]

From: A highly conserved WDYPKCDRA epitope in the RNA directed RNA polymerase of human coronaviruses can be used as epitope-based universal vaccine design

Sequence Identity %
Bepipred analysis
VRPGNFNQ 17.39
GNAAIT 41.30
DKSAGHPFN 17.39
SYQEQ 17.39
DVDNP 41.30
YPKCDRA 100.00
YYVKPGGTSSGDATTAY 17.39
IEDB analysis
DYKVQLFEKYFKY 17.39
HANCVNCTDDRCVLHCANFNVLFAM 17.39
KTCFGPIVRKIFVDGVPFVVSCGYHYKELGLV 17.39
VSLHRHRLSLK 17.39
ADPAMHI 17.39
SSNAFLDLRTSCFSVAALTTG 17.39
YDFVVSKG 17.39
SVTLKHFFFA 17.39
DYNYYSYN 17.39
PTMCDIKQMLFCMEVVNKYFEI 17.39
DGGCLNASEVVVNN 17.39
KARVYYESM 17.39
LKYAIS 100.00
TVAGVSILS 41.30
GATCVIGTT 17.39
LKTLYKDV 17.39
YPKCDRA 100.00
CRIFASLILARKHGTCCTT 17.39
YRLANECAQVLSEYVLCGGGYYVKPG 17.39
ANSVFNILQA 17.39
TANVSAL 17.39
Surface accessibility prediction analysis
HRHRLS 17.39
GNFNQDF 41.30
TDYNYYSYNL 17.39
ARVYYESMSYQEQD 17.39
AKNRAR 56.52
MTNRQYHQKML 17.39
TLYKDVD 17.39
WDYPKC 100.00
TRDRFY 17.39